PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001906.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GATA
Protein Properties Length: 233aa    MW: 24242.2 Da    PI: 7.6221
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001906.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.4e-18137170134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++C + +Tp+WR+gp g++tLCnaCG+++++ +
  Do001906.1 137 CTHCASEETPQWRQGPAGPSTLCNACGVRFKSGR 170
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.018131167IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-15131185IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.95E-14134195No hitNo description
Gene3DG3DSA:3.30.50.103.2E-14135168IPR013088Zinc finger, NHR/GATA-type
PfamPF003204.4E-16137170IPR000679Zinc finger, GATA-type
PROSITE patternPS003440137162IPR000679Zinc finger, GATA-type
CDDcd002028.70E-16137185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MTAAATMAGG GAADENPAAA DALAAGADAS LNAFFDHAGL ELVAAGGGQG SEEEEELEWL  60
SNMDAFPSVE TMAVEVEAAP SRPEAGVGRL EALPHVVGPR TKGLRRRRRV MAPWSLPPVL  120
PPRPPPAGGG AAPRRRCTHC ASEETPQWRQ GPAGPSTLCN ACGVRFKSGR LFPEYRPINS  180
PTFSPLLHSN SHRRVLEMRH HVEEETAAGG GHAGASARRA ERAAARAAAA GGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0184184e-94BT018418.1 Zea mays clone EL01N0356F04.d mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987179.11e-88PREDICTED: GATA transcription factor 7
SwissprotO655159e-33GATA7_ARATH; GATA transcription factor 7
TrEMBLK7WH514e-79K7WH51_MAIZE; Putative GATA transcription factor family protein
STRINGGRMZM2G532534_P011e-78(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-32GATA transcription factor 1